PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v0966230.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 158aa    MW: 18442.3 Da    PI: 10.1267
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v0966230.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-52111321128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhP+deelv++yL kkv++++  l   + +vd++k+ePwd+p++v  + kewyf+++rd+kyatg r+nrat+sgyWkatgkd+++++
  Lj3g3v0966230.2  11 LPPGFRFHPRDEELVCDYLMKKVTHSDSLL---MIDVDLNKCEPWDIPACV--GGKEWYFYTQRDRKYATGLRTNRATSSGYWKATGKDRAIHR 99 
                      79**********************999544...789************776..779*************************************9 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g+lvg++ktLvfy+grapkg+kt+Wvmhe+r+
  Lj3g3v0966230.2 100 -RGTLVGMRKTLVFYQGRAPKGRKTEWVMHEFRI 132
                      .999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-592156IPR003441NAC domain
PROSITE profilePS5100555.64211156IPR003441NAC domain
PfamPF023655.3E-2812132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MSNISMVEAK LPPGFRFHPR DEELVCDYLM KKVTHSDSLL MIDVDLNKCE PWDIPACVGG  60
KEWYFYTQRD RKYATGLRTN RATSSGYWKA TGKDRAIHRR GTLVGMRKTL VFYQGRAPKG  120
RKTEWVMHEF RIEGPHGPPK IPSSKEDWVL CRVFYKSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-49615715169NAC domain-containing protein 19
3swp_C3e-49615715169NAC domain-containing protein 19
3swp_B3e-49615715169NAC domain-containing protein 19
3swp_A3e-49615715169NAC domain-containing protein 19
3swm_D3e-49615715169NAC domain-containing protein 19
3swm_C3e-49615715169NAC domain-containing protein 19
3swm_B3e-49615715169NAC domain-containing protein 19
3swm_A3e-49615715169NAC domain-containing protein 19
4dul_B3e-49615712166NAC domain-containing protein 19
4dul_A3e-49615712166NAC domain-containing protein 19
1ut7_B3e-49615712166NO APICAL MERISTEM PROTEIN
1ut7_A3e-49615712166NO APICAL MERISTEM PROTEIN
1ut4_B3e-49615712166NO APICAL MERISTEM PROTEIN
1ut4_A3e-49615712166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.76090.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7256871e-167KF725687.1 Ammopiptanthus mongolicus NAC domain-containing protein (NAC3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003595973.11e-111NAC transcription factor-like protein
SwissprotQ84TE61e-89NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLF6KIF11e-111F6KIF1_MEDTR; NAC transcription factor-like protein
TrEMBLW0C8Y81e-111W0C8Y8_9FABA; NAC domain-containing protein
STRINGGLYMA15G40510.11e-108(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.27e-91NAC domain containing protein 1